4.78 Rating by CuteStat

This website is a sub-domain of ibx.com. It has a global traffic rank of #92013 in the world. This website is estimated worth of $ 158,400.00 and have a daily income of around $ 220.00. As no active threats were reported recently by users, owa.ibx.com is SAFE to browse.

PageSpeed Score
91
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 18,296
Daily Pageviews: 109,776

Estimated Valuation

Income Per Day: $ 220.00
Estimated Worth: $ 158,400.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 60,600
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 92,013
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

144.42.100.138

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822
SafeNet Authentication Form - Outlook Web Access

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 8
Google Adsense: Not Applicable Google Analytics: Not Applicable

HTTP Header Analysis

HTTP/1.1 200 OK
Server: Microsoft-IIS/8.5
X-FRAME-OPTIONS: SAMEORIGIN
X-Powered-By: ASP.NET
X-FEServer: MBX02
Date: Mon, 09 Dec 2019 10:27:29 GMT
Connection: close
Content-Length: 16046

DNS Record Analysis

Host Type TTL Extra
owa.ibx.com A 299 IP: 144.42.100.138

Similarly Ranked Websites

Pagii.com

- pagii.com
92,014 $ 158,400.00

TransIP | STACK - Jouw online cloud opslag

- stackstorage.com

STACK is online cloud opslag voor het gemakkelijk bewaren, synchroniseren en delen van al je bestanden

92,014 $ 158,400.00

Forums - Miller Welding Discussion Forums

- forum.millerwelds.com

vBulletin Forums

92,014 $ 158,400.00

Jornal Correio Paulista | A Marca da Comunicação

- correiopaulista.com
92,015 $ 158,400.00

Elite Marketing Pro | Welcome

- seanlynnwyman.elitemarketingpro.com

Elite Marketing Pro is a global community of over 50,000 active small business entrepreneurs, providing targeted education, training, and mentoring programs

92,015 $ 90,000.00