Web Analysis for Ibx Owa - owa.ibx.com
4.78
Rating by CuteStat
This website is a sub-domain of ibx.com. It has a global traffic rank of #92013 in the world. This website is estimated worth of $ 158,400.00 and have a daily income of around $ 220.00. As no active threats were reported recently by users, owa.ibx.com is SAFE to browse.
PageSpeed Score
91
Siteadvisor Rating
No Risk Issues
Traffic Report
Daily Unique Visitors: | 18,296 |
Daily Pageviews: | 109,776 |
Estimated Valuation
Income Per Day: | $ 220.00 |
Estimated Worth: | $ 158,400.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 60,600 |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | No Risk Issues |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | 92,013 |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 8 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
HTTP Header Analysis
HTTP/1.1 200 OK
Server: Microsoft-IIS/8.5
X-FRAME-OPTIONS: SAMEORIGIN
X-Powered-By: ASP.NET
X-FEServer: MBX02
Date: Mon, 09 Dec 2019 10:27:29 GMT
Connection: close
Content-Length: 16046
Server: Microsoft-IIS/8.5
X-FRAME-OPTIONS: SAMEORIGIN
X-Powered-By: ASP.NET
X-FEServer: MBX02
Date: Mon, 09 Dec 2019 10:27:29 GMT
Connection: close
Content-Length: 16046
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
owa.ibx.com | A | 299 |
IP: 144.42.100.138 |
Similarly Ranked Websites
TransIP | STACK - Jouw online cloud opslag
- stackstorage.com
STACK is online cloud opslag voor het gemakkelijk bewaren, synchroniseren en delen van al je bestanden
92,014
$
158,400.00
Forums - Miller Welding Discussion Forums
- forum.millerwelds.com
vBulletin Forums
92,014
$
158,400.00
Elite Marketing Pro | Welcome
- seanlynnwyman.elitemarketingpro.com
Elite Marketing Pro is a global community of over 50,000 active small business entrepreneurs, providing targeted education, training, and mentoring programs
92,015
$
90,000.00